|
G y.. MahJong Connect Industrial Zombi Strategy Games Treasure of Cutlass Reef Ahoy mates and shiver your timbers for a epic only seen in the mo.. Bowman 2 Practice archery, battle against human, computer archers or simpl.. Territory WAR In Territory WAR, use your men and their weapons, grenades, rifle.. Final Fantasy So Sonic RPG Eps 7 Sports Games Billiards Play against a player or computer, use your cue to hit the pool b.. DownHill Jam Going downhill on your skateboard never been so much fun! Side Kick A classic soccer game all in flash, pick your country and compete.. Watch Out Behind 2D Knockout Racing Games Drag Racer v3 In Drag Racer v3 you race against other cars, modify your car, bu.. Stunt Dirt Bike Get dirty on your bike. Ride your bike across obstacles perfectl.. Rich Racer In this challenging car racing game you have to beat your opponen.. 123 GO Gorillaz: Final Shooting Games Castle Clout Return Of The King In Castle Clout 2 you will again have to destroy the enemies cast
anime dress game newgrounds up Deleted; expires=Mon anime dress game newgrounds up, 12-Jan-2009 16:52:40 GMT; path= ; domain=.newgrounds.com Connection: close Content-Type: text html oxCuteGirlxo Newgrounds.com — Everything anime dress game newgrounds up, By Everyone. Checking login status… Not a member? SIGN UP! Forgot login? USERNAME: PASSWORD: Save Info! Jack In! > Logging in… Logged in as:. Logging out… Inbox My Account Log Out Title Author Search! New art portal! About Newgrounds Blogs Chat Downloads Help FAQ Lit Mature Network Rankings Submit Content! Flash Portal Audio Portal Art Portal Games Movies Collections Series Forums Store oxCuteGirlxo Reviews Favorites News Main NG Home oxCuteGirlxo Age Gender: 21 anime dress game newgrounds up, Female Location: miami anime dress game newgrounds up, florida anime dress game newgrounds up, NY I'm very socialite and i love boys almost as i love anime!.............. ......n_n Contact Info Send a Private Message (PM) Newgrounds Stats Sign-Up Date:5 3 08 Level: 2 Aura: Evil Rank: Civilian Blams: 0 Saves: 0 Rank : 0 Whistle Status: Normal Exp. Points: 20 50 Exp. Rank : 917 anime dress game newgrounds up, 833 Voting Pow.: 1.98 anime dress game newgrounds up.
anime dress game newgrounds up Timor Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Falkland Islands (Malvinas) Faroe Islands Fiji Finland France France anime dress game newgrounds up, Metropolitan French Guiana French Polynesia French Southern Territories Gabon Gambia Georgia Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guam Guatemala Guinea Guinea-Bissau Guyana Haiti Heard and Mc Donald Islands Holy See (Vatican City State) Honduras Hong Kong Hungary Iceland India Indonesia Iran (Islamic Republic of) Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea anime dress game newgrounds up, Democratic People's Republic of Korea anime dress game newgrounds up, Republic of Kuwait Kyrgyzstan Lao People's Democratic Republic Latvia Lebanon Lesotho Liberia Libyan Arab Jamahiriya Liechtenstein Lithuania Luxembourg Macau Macedonia anime dress game newgrounds up, the Former Yugoslav Republic of Madagascar Malawi Malaysia Maldives Mali Malta Marshall Islands Martinique Mauritania Mauritius Mayotte Mexico Micronesia anime dress game newgrounds up, Federated States of Moldova anime dress game newgrounds up, Republic of Monaco Mongolia Montserrat Moroc.
anime dress game newgrounds up Esflashdrivenflashgameflashgames247flashgamesbankfunny-basegamebrewgamedfreegameprisongamesforworkgamesgamesgamesvinegameyankerminiclipnewgroundsonlineflashgamesposzkolevx4 Anime Dress Up 4 « Back to list Save to list Save to quicklist Added Play fullscreen Add game to your list --- Select --- Create new Save quick list to your list List name: Views: 861 (2 votes) Rate it Share with your friends Share link: Original file data Embed code: Find more flash games like this on games.filestube.com. Comments (0) Show: all commentsgood (+5 or better)average (0 or better)poor (-5 or better) Next Last Submit your comment Only logged-in users may post comments. Log in or sign up if you don't have an FilesTube account. Recent searches bejewled 4m 9s ago chuckie egg 3m 38s ago liners 4m 32s ago lines 4m 25s ago mini golf 2m 5s ago naruto 1m 19s ago porn 1m 24s ago sex 1m 29s ago sex teacher 1m 41s ago sonic 1m 39s ago What is viral today ? Game details Added: 2008-04-29 00:00:00 Tags: Your ta.
anime dress game newgrounds up 
anime dress game newgrounds up | | | | | |
anime dress game newgrounds up
Icmoo2 Oct 21, 2008, 11:00:17 AM Wow wonderfulI love dress up gamesbut I& 039;ve only made one because I don& 039;t actually have flash and have to use our schools over a number of lunchtimes which is way to much effort for lazy me I hope u make lots more -- weird but true ~ninjar-pirate Oct 21, 2008, 11:07:50 AM This is amazing for your first try! I love the music, a very cute choice!A few tips-some of the hairs are a little out with the hat...But otherwise, excellent! I love this, insta -- *lurk lurk* ~MisoStudios Oct 21, 2008, 7:34:22 PM you should be proud, that& 039;s amazing! Awesome job I could never make something so awesomeful ^^-- CEO and Administrator to Dan Bouru Bako Studio and Cosplay club! ~petewentz103 Oct 21, 2008, 10:05:34 PM yep it works on newgrounds ^-^awesome job btw-- kiss me......im emo ---i dont care what you think as long as its about methe best of us can find happiness in misery... Previous Page1234Next Page Sign up to leave feedback! My First Dress Up Game b
|
